PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 531aa    MW: 60874.5 Da    PI: 6.4686
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00414genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.8e-103654021954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  AA31G00414 365 FEHflHPYPKESEKILLAKQTGLSKNQVANWFINARVR 402
                 665559******************************88 PP

2BELL123.11.2e-39227298172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe v+glg+akpYts+Al++iSrhFrcL+dai++qi
  AA31G00414 227 ERQELQSKKNKLLTMVDEVDKRYNQYYHQMEALASSFELVTGLGAAKPYTSVALNRISRHFRCLRDAIKGQI 298
                 79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.2E-53162296IPR006563POX domain
PfamPF075265.5E-45168294IPR006563POX domain
PROSITE profilePS5007112.309343406IPR001356Homeobox domain
SMARTSM003892.1E-9346410IPR001356Homeobox domain
CDDcd000863.68E-11346407No hitNo description
SuperFamilySSF466892.27E-17347413IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-28349412IPR009057Homeodomain-like
PfamPF059203.7E-17363402IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MAVYYPNNGG NMQNLYQESI YLTEQQQQQA SSSSAASFIS GNVNGGGEIP RNEMMFIPPN  60
GDLNGNVTVS SNDLSFHGQG LSLSLGNQIQ YQQYHQNISN QLGFNNQNHT SLSCNVDEIG  120
KSKEMLLEQS QVVHHHQQQQ QINNHSNASV GFYNNNYRYE NSGFVSSVLR SRYLKPTQQL  180
LDEVVNVRRD LKQGVKKIKG DDQFRNDVDQ DLVSDDSVKA VELSSSERQE LQSKKNKLLT  240
MVDEVDKRYN QYYHQMEALA SSFELVTGLG AAKPYTSVAL NRISRHFRCL RDAIKGQIQL  300
IKTKLGEKES SDEQGGERIP RLRYLDQRLR QQRALHQQLG MVRPAWRPQR GLPENSVSIL  360
RAWLFEHFLH PYPKESEKIL LAKQTGLSKN QVANWFINAR VRLWKPMIEE MYKEEFGETE  420
LVSSKSCQET NNTTETSSSH PKHEETSQNL TYSSVEQNLV FSEPKQARVL QGEEVDDEQP  480
QEMMNRTSTS TDYDNLMNYH GFGLDDYRYI GLGNQQDSRF SNPHQLHDFV V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A7e-16352410563Homeobox protein Meis2
3k2a_B7e-16352410563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077827.10.0BEL1-like homeodomain 3
RefseqNP_177674.10.0BEL1-like homeodomain 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLD7KSP00.0D7KSP0_ARALL; Putative uncharacterized protein
TrEMBLV4KK100.0V4KK10_EUTSA; Uncharacterized protein
STRINGAT1G75410.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3